SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000329 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000329
Domain Number 1 Region: 8-126
Classification Level Classification E-value
Superfamily Histone-fold 1.2e-59
Family Nucleosome core histones 0.00000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000329   Gene: ENSTTRG00000000351   Transcript: ENSTTRT00000000350
Sequence length 126
Comment pep:novel scaffold:turTru1:scaffold_104694:6043:6423:1 gene:ENSTTRG00000000351 transcript:ENSTTRT00000000350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEFAKSTPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
Download sequence
Identical sequences ENSTTRP00000000329 ENSTTRP00000012762 XP_004286153.1.21590 XP_004317752.1.83887 XP_007449307.1.90284 ENSTTRP00000000329 ENSTTRP00000012762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]