SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000376 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000376
Domain Number 1 Region: 31-163
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.37e-46
Family Regulator of G-protein signaling, RGS 0.00000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000376   Gene: ENSTTRG00000000403   Transcript: ENSTTRT00000000403
Sequence length 170
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_817:106089:117082:-1 gene:ENSTTRG00000000403 transcript:ENSTTRT00000000403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTVRNEERGENAGRPTHTTKMESIQVLEECQNPTSDEVLSWSQNFDKMMKAPAGRNLFRE
FLRTEYSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVIN
RNLLDPNAHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVESTASSTSES
Download sequence
Identical sequences ENSTTRP00000000376 ENSTTRP00000000376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]