SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000432 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000432
Domain Number 1 Region: 735-910
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-40
Family DBL homology domain (DH-domain) 0.0000891
Further Details:      
 
Domain Number 2 Region: 920-1035
Classification Level Classification E-value
Superfamily PH domain-like 1.88e-34
Family Pleckstrin-homology domain (PH domain) 0.001
Further Details:      
 
Domain Number 3 Region: 190-330
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000994
Family CRAL/TRIO domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000432   Gene: ENSTTRG00000000460   Transcript: ENSTTRT00000000460
Sequence length 1195
Comment pep:known_by_projection scaffold:turTru1:scaffold_110090:125554:132282:-1 gene:ENSTTRG00000000460 transcript:ENSTTRT00000000460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGPLEEGDESSASQGHPTDWRFAVCSFRDAWDEGEAALQMQDPNPPSPPAGAAQGEGLQ
GSPLPSELQSTPGQKVADGSGDGQRGILGGSLVQREEPASSGMEILLCPMFSHLSLAQGE
NDSQGGGLAGDSVSGRAMPIRLDPEGLDSDPVDLGDLLSETSSELLEADPNGSRLLKSTD
CLLAQDLAWELLASGLAALPGTRDVEGRAVLLLSAHNPAWLHPKCSSHELIRLLLYLRSI
PRPKVQALGLTVLVDARICSPISSLFWGLSQLQEAAPGSVHQVLLIGKMPQEVPSGLQLE
QLSSDQSLLTHISTSGLPTSLGGGLPYCHQAWLGFRMRLETLQQSCQVLCALLQGAIESM
KAVPQPMESGEVGRLLQQARVLMQHVLDSPQLAWLQCQGALELAWLKQEVPEVTLSPDYR
PAVDEVEELYGRVDGLLHQLTLQSNQRVQALELVQMLEAQEGELHQIEVWLQQVGWPALE
EPREPSLDMLLQAQGPFGDLDRIAQEQVRRGEKLLQPLVGWDAAELGPAGARFLTLQAQL
TDFCRALAQRRQRLADAERLLQLFRQALMWAEEGQRVLAELEQERPGVVLQRLQLHWTKH
PDLPPAHFRKMWALATGLGSEGIRQECRWAWARCQDTWLALDQKSEAAVKPSLTGSTASL
CVSRVLAVPPSSPLRKAYSLDRNLGLSLRESAHHCHHEAIVAACHRPEAGVGAQSGSCPT
MPPPGGSEPRSPNRLHLVLAEMVATEREYVRALDYTMENYFPELDRPDVPQGLRGQRAHL
FGNLEKLRDFHRHFFLRELEACTQHPPRVAYAFLRHRVQFGMYALYSKNKPCSDALMTSY
GHIFFRDKQQALGDHLDLASYLLKPIQRMSKYTLLLQELVRACGGTVPELSALRAAQSLV
RFQLRHGNDLLAMDAIQGCDVNLKEQGQLVRQDEFTVCFGRHKSLRRVFLFEELLLFSKP
RRGPKGIDTFAYKRSFKMADLGLTECSGDSNLRFEVWFRRRKARDTFVLQAASLATKQAW
TADISRLLWRQAVHNKEVRMAEMVSLGVGNKAFQDIAPSKEAINDRTVNYILKCQEVRSR
ASIAVAPFDYDSPYLGASSSLSGDPASCSVLGSLNLHLYRDPAVLGFRWPLYSTGFPEEA
VLETEAELGSQPSLIPEDSEVSSQCPSASGSSGSDSSCVSGQALGRGLEDLSYVR
Download sequence
Identical sequences ENSTTRP00000000432 ENSTTRP00000000432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]