SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000456 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000456
Domain Number 1 Region: 196-317
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 8.1e-49
Family Anticodon-binding domain of Class II aaRS 0.000000436
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000456   Gene: ENSTTRG00000000487   Transcript: ENSTTRT00000000486
Sequence length 579
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1131:38925:56241:-1 gene:ENSTTRG00000000487 transcript:ENSTTRT00000000486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTAPSRPSPTRRDPYGFGDSRDTRRDRSPIRGSPRREPRDGRNGRDARDSRDMRDPRDL
RDHRESRDIRDHRDSRSMRDARDMRDPRDFRDLRDSRDFRDHRDPMYDRYRDMRDSRDPM
YRREGSYDRYLRMDDYCRRKDDSYFDRYRDSFDGRGPPGPESQSRAKERLKREERRREEL
YRQYFEEIQRRFDAERPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQ
ALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNE
CREKEREEIARQAAKMADEALLQERERGGPEEGLRGGHPPAIQSLINLLADNRYLTAEET
DKIINYLRERKERLMRSSADSLPGPISRQPLGATSGASLKTQPSSQTLQSGQVLPSATPT
PAAPPTSQQELQAKILSLFNSGTVVANSSSASPSVAAGNTQNQNFSIAANSQPQQRSQAS
GNQPPNILGQAGSARNMGPRPGAPSQGLFGQPSTRLAPASNLASQRPVSSTGINFDNPSV
QKALDTLIQSGPALSHLVSQTTAQVGRPQAPMGSYQRHY
Download sequence
Identical sequences XP_004320551.1.83887 ENSTTRP00000000456 ENSTTRP00000000456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]