SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000530 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000530
Domain Number 1 Region: 26-220
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.65e-61
Family Proteasome subunits 0.00000000805
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000530   Gene: ENSTTRG00000000566   Transcript: ENSTTRT00000000565
Sequence length 238
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1660:18077:19987:1 gene:ENSTTRG00000000566 transcript:ENSTTRT00000000565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAALVAARGARPAPAWGPEAITPDWENREVSTGTTIMAVQFEGGVVLGADSRTTTGSYI
ANRVTDKLTPIHDRIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEM
CYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREG
MTKEECLQFTANALALAMERDGSSGGVIRLAAIAESGVERQVLLGDQIPKFTIATLPH
Download sequence
Identical sequences ENSTTRP00000000530 ENSTTRP00000000530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]