SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000572 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000572
Domain Number 1 Region: 162-379
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 0.0000000000016
Family Gamma-glutamyltranspeptidase-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000572   Gene: ENSTTRG00000000608   Transcript: ENSTTRT00000000609
Sequence length 445
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_273:485758:488145:-1 gene:ENSTTRG00000000608 transcript:ENSTTRT00000000609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEPIAGPVLYQKLLVWEPSLESEEEEGEISEQLIPHPSGPQDSSGNKAGSLPGLVAVGFS
LSVRQLQSCASPGTLGSGAPPASGRSHRPGVYHRGSIIGPTXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXGNSTATSTPAPGLGLPSALPAHLLHTGFGRLPSP
HLLVGPTILAQEGFLVDAAQGTKGLCPLLCHTDGTPLGPGARATNPKLAAVLHRAALAPT
PDLARDALLSLGLEGPSARPMPTLEPALQLPVPQGILFTTPSPSAGLELLEVALQSGGRP
CPAPLQAAVSPGSSVLATVDSSGSVLLTSSLNSSFSSGRLSPSAGVLLSKLVAESANSAW
ACPLILLDSSDDADVLGLMPSGTPAAARVMTHSLLSYLAGPQTQAQQGPTEPGACGQGTL
LQVSAHAEHAHVSSVPSGCCSFQGF
Download sequence
Identical sequences ENSTTRP00000000572 ENSTTRP00000000572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]