SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000635 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000635
Domain Number 1 Region: 273-486
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.06e-60
Family DBL homology domain (DH-domain) 0.0000000651
Further Details:      
 
Domain Number 2 Region: 471-625
Classification Level Classification E-value
Superfamily PH domain-like 1.96e-45
Family Pleckstrin-homology domain (PH domain) 0.0000048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000635   Gene: ENSTTRG00000000676   Transcript: ENSTTRT00000000676
Sequence length 687
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1421:159412:266837:1 gene:ENSTTRG00000000676 transcript:ENSTTRT00000000676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPWEEQPGKKPSCSRSLKAFHTEPAQGPFSTAETGTWSLPFISAEDVPRETPSQPRSTSQ
HSHISLDDLWLEKMQRRKLKKLAQFERKMHACKDGIQCWRKMTITSPESLNLPRRSHPFS
QSAPTGLNHMGWPEPIPDIALPDGALDTALRADEAGSEEDLYEDVHSSSHHYSHPGGGGE
QLAINEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXLRVNQDEPADDAALGTGHGGAGHGGAEAQSSKDQMRTNVINEILSTERDYIKHL
RDICEGYLRQCRKRVDMFSEEQLRTIFGNIEDIYRCQKAFVKALEQKFNRERPHLSELGA
CFLEHQADFQIYSEYCNNHPNACVELSRLAKLSKYVYFFEACRLLQKMIDISLDGFLLTP
VQKICKYPLQLAELLKYTHPQHRDFKDVEAALHAMKNVAQLINERKRRLENIDKIAQWQS
SIEDWEGEDLLVRSSELIHSGELTRVTQPQAKSQQRMFFLFDHQLIYCKKDLLRRDVLYY
KGRLDLDGLELVDLEDGKDGELHVSVRNAFRLRCGPSGESQLLCAKKPEQKQRWLKAFAR
ERDQVRLDQETGFSITQLKKEAVMLIASQHQAAGKPKALSRPYYLTRQKHPALPTSLPQQ
QVLVLAEPKRKPSTFWHSISRLAPFRK
Download sequence
Identical sequences ENSTTRP00000000635 ENSTTRP00000000635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]