SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000662 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000662
Domain Number 1 Region: 4-240
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 9.57e-65
Family Proteasome subunits 0.00000000684
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000662   Gene: ENSTTRG00000000702   Transcript: ENSTTRT00000000703
Sequence length 258
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1442:123323:128016:1 gene:ENSTTRG00000000702 transcript:ENSTTRT00000000703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRYDSRTTIFSPEGRLYQVEYAMQARHATCAILANDGVLLAAXXXXXXXXXXXXXXXX
XXXXXXXDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQ
FGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGE
MTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKHEEE
EAKAEREKKEKEQKEKDK
Download sequence
Identical sequences ENSTTRP00000000662 ENSTTRP00000000662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]