SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000674 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000674
Domain Number 1 Region: 193-371
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.99e-41
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0063
Further Details:      
 
Domain Number 2 Region: 358-468
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.46e-16
Family Anticodon-binding domain of Class II aaRS 0.011
Further Details:      
 
Domain Number 3 Region: 67-109
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 0.0000272
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000674   Gene: ENSTTRG00000000716   Transcript: ENSTTRT00000000716
Sequence length 472
Comment pep:known_by_projection scaffold:turTru1:scaffold_112476:79107:80851:1 gene:ENSTTRG00000000716 transcript:ENSTTRT00000000716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGLLTRCRALPALATCSHQLSGYVPHRFHHRAPGRGKRLVLSRMFQPQNLREDQVLSLE
GRSGELTCKSQRLMLQVGLIHPASSGCYHLLPYTVRAMEKLVRVIDQEMXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXRPRFGLSREFYMKDMYTFDSSETAQQTYNVVCDAYSSLFDRLGLQCVK
VQADVGSIGGTMSHEFQLPVDVGEDRLAVCSGCGFSANMETLDLSPTNCPACQGPLTKTK
GIEVGHTFYLGTKYSSIFSAQFTNVHGKPSLAEMGCYGLGVTRILAAVIEALATEDCIRW
PGLLAPYQVCLISPKKGSKEEAATELTGHLYDHITEAVPQLRGEVLLDDRTHLTIGNRLK
DANKFGYPFVIIAGKRALDDPAHFEVWCQNTGEVVFLTREGVLELLSQVQVV
Download sequence
Identical sequences ENSTTRP00000000674 ENSTTRP00000000674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]