SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000701 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000701
Domain Number 1 Region: 158-203,245-464
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.63e-53
Family Papain-like 0.0000314
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000000701
Domain Number - Region: 74-108
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000981
Family Somatomedin B domain 0.0047
Further Details:      
 
Domain Number - Region: 93-153
Classification Level Classification E-value
Superfamily FnI-like domain 0.023
Family VWC domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000701   Gene: ENSTTRG00000000744   Transcript: ENSTTRT00000000744
Sequence length 474
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3464:775673:870149:1 gene:ENSTTRG00000000744 transcript:ENSTTRT00000000744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTGYKILILSYLTTEIWMERQYLSQREVDRGANFTRNHTILEGTRFKRAIFKGQYCRSF
GCCEDRDDACVTQFYERNALCYCDKFCERENSDCCPDYKSFCREKKGWPPHTKPWYPEGC
HRDGQRYEEGSVIKENCNSCTCSGQQWKSQHVCLQPGLIEHVNKGDYGWTAQNYSQFWGM
TLEEGFTYRLGTLPPSPLLLSMNEVAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXVAADRIAIQSKGRYTANLSPQNLISCCGKNHHGCNSGSIDRAWWYLRRRGLV
SHACYPLFKDQNATNNGCAMTSRSDGRGKRHATKPCPNSIEKSNRIYQCSPPYRVSSNET
EIMKEIMQNGPVQAIMQVHEDFFNYKKGIYRHVTSTNEESEKYQKLHTHAVKLTGWGTLR
GAKGRKEKFWIAANSWGKSWGENGYFRILRGVNESDIEKLIIAAWGQLTSSDEP
Download sequence
Identical sequences ENSTTRP00000000701 ENSTTRP00000000701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]