SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000735 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000735
Domain Number 1 Region: 1-157,187-217
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.29e-53
Family BAR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 304-361
Classification Level Classification E-value
Superfamily SH3-domain 7.08e-16
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000735   Gene: ENSTTRG00000000781   Transcript: ENSTTRT00000000781
Sequence length 362
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_466:10645:35331:1 gene:ENSTTRG00000000781 transcript:ENSTTRT00000000781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTEEKLGQAEKTELDAHLENLLSKAECTKIWTEKIMKQTEVLLQPNPNARIEEFVYEKLD
RKAPSRINNPELLGQYMIDAGTEFGPGTAYGNALIKCGETQKRIGTADRELIQTSALNFL
TPLRNFIEGDYKTIAKERKLLQNKRLDLDAAKTRLKKAKAAETRASQLNSARLEGDNIMI
WAEEVTKSEQELRITQSEFDRQAEITRLLLEGISSTHXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXFPSVYHCNNNQTSVAPIPSASSNVIGSSPLTSTSGLVITSPSNLTDLKE
CSGSRKARVLYDYDAANSTELSLLADEVITVFSVVGMDSDWLMGERGNQKGRVPITYLEL
LN
Download sequence
Identical sequences ENSTTRP00000000735 ENSTTRP00000000735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]