SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000742 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000742
Domain Number 1 Region: 141-322
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.96e-60
Family Brix domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000742   Gene: ENSTTRG00000000789   Transcript: ENSTTRT00000000789
Sequence length 349
Comment pep:known_by_projection scaffold:turTru1:scaffold_98301:10090:29315:-1 gene:ENSTTRG00000000789 transcript:ENSTTRT00000000789 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKAGEKSGGSGNKGLKRKAATEEPQEAAVAEDGTTESGVQPSKAAAFPPGFSVSEIKNK
QRRHLMFTRWKQQQRKEKLAAKKKLKKEREALGDKAPPKPIPKTIDNQRVYDETTVDPND
EEVAYDEATDEFASYFNRQTSPKILITTSDRPHGRTVRLCEQLSTVIPNSHVYYRRGLAL
KKIIPQCISRDFTDLIVINEDRKIPNGLILSHLPNGPTAHFKMSSVRLRKEIKRRGKDPT
EHIPEIILNNFTTRLGHSVGRMFASLFPHNPQFIGRQVATFHNQRDYIFFRFHRYIFKSE
KKVGIQELGPRFTLKLRSLQKGTFDSKYGEYEWVHKPREMDTSRRKFHL
Download sequence
Identical sequences ENSTTRP00000000742 XP_019775382.1.83887 ENSTTRP00000000742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]