SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000827 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000827
Domain Number 1 Region: 1160-1221
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.83e-19
Family Complement control module/SCR domain 0.0042
Further Details:      
 
Domain Number 2 Region: 138-206
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000459
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 3 Region: 1102-1161
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000528
Family Complement control module/SCR domain 0.00072
Further Details:      
 
Domain Number 4 Region: 865-936
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000675
Family Complement control module/SCR domain 0.0000579
Further Details:      
 
Domain Number 5 Region: 622-679
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000891
Family Complement control module/SCR domain 0.0008
Further Details:      
 
Domain Number 6 Region: 684-739
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000017
Family Complement control module/SCR domain 0.0009
Further Details:      
 
Domain Number 7 Region: 920-981
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000315
Family Complement control module/SCR domain 0.00021
Further Details:      
 
Domain Number 8 Region: 557-619
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000144
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 9 Region: 262-321
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000208
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 10 Region: 804-860
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000107
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 11 Region: 209-270
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000222
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 12 Region: 388-445
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000005
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 13 Region: 19-76
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000537
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 14 Region: 981-1036
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000367
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 15 Region: 450-507
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000629
Family Complement control module/SCR domain 0.0033
Further Details:      
 
Domain Number 16 Region: 503-567
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000106
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 17 Region: 318-379
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000459
Family Complement control module/SCR domain 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000000827
Domain Number - Region: 118-146
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0172
Family Complement control module/SCR domain 0.0052
Further Details:      
 
Domain Number - Region: 761-799
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0418
Family Complement control module/SCR domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000827   Gene: ENSTTRG00000000875   Transcript: ENSTTRT00000000876
Sequence length 1221
Comment pep:novel genescaffold:turTru1:GeneScaffold_2257:403843:491199:1 gene:ENSTTRG00000000875 transcript:ENSTTRT00000000876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFPATVVWFMLWTVCVAKDCQEPPPRRETEILSGSWTEQTYPEGTRATYKCRPGYRTLG
SIVMVCKDGKWQSLHPSRMCQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYQM
LGEVNFRECESDGWTNNIPICEVVKCLPVTEPENGKFFSSALDPDQVYVFGQAIQFECNS
GYILDGPKQIHCSTDGIWSEEKPKCVETSCKQPTILNGYPISQKEIYKVNERVQYKCARG
FGYGERGDAVCTEFGWTPVPSCKEITCDPPYIPNGIYTPQLAKYRGEYKITYECKSGFAP
VIQGNVATCTSQGWSPAPRCSFKPCDFPVIKHGSIYGHRGYFPVSLGYWIRFDCDQYFVP
QDRRPYLTCTRNGWSPEVPCLRQCIFNYLHNGHYPNYGTKVLQGKTVRVHCYDGYSLQNN
QNTMTCTENGWSPPPRCIRVKTCSKSDIQIKNGLFSETAFTYPLNKQTKYKCKPGYVTAD
GNTSGLITCLQSGWSVQPVCIKSCDMPVFENARARSDGTWFKLNDSLDYECLDGLESRDG
HTTGSIVCGENGWSDRPACYERECSIPQMENNLDANPKKDRYRCGDVLKFSCIQGLIMVG
AVSIQCYHFGWSPNLPTCKGQVKSCAPPPQLPSGKVKDTQREEYRHSEVVEYVCNPGFLM
KGSHKIQCVDGQWTALPMCIEEKSTCGDIPELDHGYVNHSAPLYHHGDLVEFSCREAFTM
IGPRSVTCISGKWTQPPQCIATEELKKCKWSKVFASEGNPSNKIEFDHNTNISYRCRGKS
EYKHSICINGRWDPEATCKEEAQIQSCPPPPQIPNSRNMTTTVTYQDGEKISILCQENYL
IEDEEELVCKDGRWQSIPRCIEKLPCSQPPQIDHGTINSSSSAKESYAHGTKLSYTCEDG
FSISEENVITCHMGKWSSPPHCVGLPCGLPPLIQNGVVPNEKGSYQDGEEVTYDCDEGFG
IDGPASIRCLGGKWSLPPECICFNVPSFDDAILIDRKKKSYRSGEQVVFKCLPSYRLEGA
NTIQCIKSKWIGRPACRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXSQGKCGPPPPIDNGDITSFPAPVYPPGSTVEYQCQSYYELQGK
RHIVCQNGEWSEPPKCLDACVISEEMMEKHNIELKWRSDKKLYSKTDDIVEFKCKSGYCI
KASSSALRTTCREGKLAYPTC
Download sequence
Identical sequences ENSTTRP00000000827 ENSTTRP00000000827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]