SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000855 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000855
Domain Number 1 Region: 5-219
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 3.53e-68
Family D-ribulose-5-phosphate 3-epimerase 0.00000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000855   Gene: ENSTTRG00000000908   Transcript: ENSTTRT00000000908
Sequence length 228
Comment pep:novel genescaffold:turTru1:GeneScaffold_308:565020:576900:1 gene:ENSTTRG00000000908 transcript:ENSTTRT00000000908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGCKIGPSILNSDLASLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQ
LGQDPFFDMHMMVSRPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK
PGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGP
DTIHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSLDR
Download sequence
Identical sequences ENSTTRP00000016536 XP_004262819.1.21590 XP_007117739.1.24612 XP_007187908.1.59432 XP_007470081.1.90284 XP_019794567.1.83887 ENSTTRP00000000855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]