SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000878 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000878
Domain Number 1 Region: 30-141
Classification Level Classification E-value
Superfamily PH domain-like 8.5e-40
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000000765
Further Details:      
 
Domain Number 2 Region: 207-303
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 3.66e-34
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000639
Further Details:      
 
Domain Number 3 Region: 382-493
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 4.84e-25
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000878   Gene: ENSTTRG00000000931   Transcript: ENSTTRT00000000931
Sequence length 505
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1828:114254:178826:-1 gene:ENSTTRG00000000931 transcript:ENSTTRT00000000931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSGQQQPPPPRRVTNVGSLLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKK
CSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALN
FANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQVN
NISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDLCG
ISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHSSGPP
PPPARGRGAPPPPPSRAPSAAPPPPPPSRPGVGVPPPPPNRMYPPPPPALPSSAPSGPPP
PPPPMSVAGPAAPPPPPPPPPPPGPPPPPGLPSDGDHQVPTSAGSKAALLDQIREGAQLK
KVEQNSRPVSCSGRDALLDQIRQGIQLKSVSDGPESTPPTPAPTSGIVGALMEVMQKRSK
AIHSSDEDEDEDDEEDFEDDDEWED
Download sequence
Identical sequences ENSTTRP00000000878 XP_004265540.1.21590 XP_019780188.1.83887 XP_019780196.1.83887 ENSTTRP00000000878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]