SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000918 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000918
Domain Number 1 Region: 172-500
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.41e-95
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000131
Further Details:      
 
Domain Number 2 Region: 26-151
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.59e-33
Family Anticodon-binding domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000918   Gene: ENSTTRG00000000974   Transcript: ENSTTRT00000000974
Sequence length 501
Comment pep:known_by_projection scaffold:turTru1:scaffold_113991:10575:76067:-1 gene:ENSTTRG00000000974 transcript:ENSTTRT00000000974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSASACRKSQEKPREIMDAAEDYAKERYGVSSMIQSQEKPDRVLVRISDLTVQKADEVV
WVRARVHTSRAKGKQCFLVLRQQQFNVQALAAVGDHASKQMVKFAANINKESIIDVEGVV
RKVNQKIGSCTQQDVELHVQKIYVISSAEPRLPLQLDDAVRPEVEGEEEGRATVNQDTRL
DNRVIDLRTSTSQAVFRFQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTVSYF
KNNAYLAQSPQLYKQMCICADFEKVFCIGPVFRAEDSNTHRHLTEFVGLDIEMAFNYHYH
EVVEEIADTLVQIFKGLQERFQTEIQTVNKQFPCEPFKFLEPTLRLEYCEALAMLREAGI
EMGDEEDLSTPNEKLLGRLVKEKYDTDFYILDKYPLAVRPFYTMPDPRNPKLSNSYDMFM
RGEEILSGAQRIHDPQLLTERALHHGIDLEKIKAYIDSFRFGAPPHAGGGIGLERVTMLF
LGLHNVRQTSMFPRDPKRLTP
Download sequence
Identical sequences ENSTTRP00000000918 XP_004265496.1.21590 XP_004316558.1.83887 ENSTTRP00000000918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]