SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001147 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001147
Domain Number 1 Region: 250-602
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.35e-115
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000224
Further Details:      
 
Domain Number 2 Region: 99-242
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.83e-37
Family Anticodon-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001147   Gene: ENSTTRG00000001221   Transcript: ENSTTRT00000001221
Sequence length 625
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2562:296005:308729:-1 gene:ENSTTRG00000001221 transcript:ENSTTRT00000001221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTQAAVRLVRGSLRQTSWAQWGQRELRLCQLALLTTIHKDKPLFDKRSELKRRLKAEKK
IAEKEAKQKELSEKQLSQAAAAATSHTADNGVGAEEESLDPNQYFKIRSQAVHQLKVSGE
DPYPHKFHVDISLTHFIQEYSHLQPGEHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGV
KLQVMANSRNYKSEEEFIRINSKLRRGDIIGVQGNPGKTKKGELSIIPYEVTLLSPCLHM
LPHLHFGLKDKETRFRQRYLDLILNDFVRQKFIIRSKIITYIRHFLDELGFLEIETPMMN
IIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRIYEIGRQFRNEGIDLTHN
PEFTTCEFYMAYADYHDLMEITEKMISGMVKHITGGYKVTYHPDGPEGQACEIDFTPPFR
KISMVEELEKALGVKLPETKLFETEETRKILDDICVAKAVECPPPRTTDRLLDKLVGEFL
EVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPVRQRQLF
EEQAKAKAAGDDEAMFIDETFCTALEYGLPPTGGWGMGIDRVTMFLTDSNNIKEVLLFPA
MKPEDKKENVATTDGLESTAAGTSV
Download sequence
Identical sequences ENSTTRP00000001147 ENSTTRP00000001147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]