SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001172 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001172
Domain Number 1 Region: 92-152
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000528
Family Pleckstrin-homology domain (PH domain) 0.0000522
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001172   Gene: ENSTTRG00000001247   Transcript: ENSTTRT00000001247
Sequence length 777
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_662:35892:60611:-1 gene:ENSTTRG00000001247 transcript:ENSTTRT00000001247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEGRPRSSLSLASSASTISSLGSLSTKKSTRAVSKVHAFGKRGNALRRDPNLPVHIRGW
LHKQXXXXXXXXXXXXXXXXXXXXXXXXXSREESVLGSVLLPSYSIRPDGPGAPRGRRFT
FTAEHPGMRTYVLAADTLEDLRGWLRALGRASRAEGDDCGQPRSSARPQTGEGPGGPGGP
PEVSRGEEGCGSESPEVARLSRGRGRLLTPSPMADLQSGPRIRRTRSPDLFTPFSRPPSP
LSLPRPRSAPARRPPPSSGDTAPSARPHTPLSRIDVRPPLDWAPQRQTLSRPPTPRRGPS
SEAGGGRDPRSPQHWSQEARTPAPSGSSTYLQLPPRPPGTRASMVLLPGPPLDSTFHQSL
ETDTLLTKLCGQDRLLRRLQEEIDQKQEEKEQLEAALELTRQQLGQTTREAAAPGRAWGR
QRLLQDRLVSVRAALCHLTQERERVWDTYNSLEQELSTLRETLEYLLHLGSPQDRASAQQ
QLWMVEDTLAGLGGPQKPPHHTDPDSPSPALQGKESSERESLPESLELSLPRSPEADWGR
PPGGDRELASPRSGLGSPRVSRASSPEGRRPPSPQPGTKVPLARPRMSAQEQLERMRRHQ
EYGRPLPRPASPRLLTLGRTLSPAGRQPDAEQKPVLGHSGAQKWLRSSGSWSSPRNTTPY
LPTSEGHRERVLSLSQALATEASQWHRMMTGGNLESRGDPLPPAPPPPSEPPPQVSSPPR
SPPAANSRSLGFSRRGSGRGAGPASWEPTWDSGIAPPALTQDEGAWPLRVTLLQSSF
Download sequence
Identical sequences ENSTTRP00000001172 ENSTTRP00000001172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]