SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001209 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001209
Domain Number 1 Region: 52-178
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.96e-46
Family Regulator of G-protein signaling, RGS 0.000000223
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001209   Gene: ENSTTRG00000001289   Transcript: ENSTTRT00000001289
Sequence length 205
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_964:117693:122347:1 gene:ENSTTRG00000001289 transcript:ENSTTRT00000001289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHSKRDKVVICQRVSQEEVKKWA
ESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFIS
VQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLANL
SSCGSEKQKGAKSSTDCPSLVPQCA
Download sequence
Identical sequences ENSTTRP00000001209 XP_019787512.1.83887 ENSTTRP00000001209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]