SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001234 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001234
Domain Number 1 Region: 2-113
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-29
Family Spermadhesin, CUB domain 0.00000123
Further Details:      
 
Domain Number 2 Region: 184-253
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000361
Family Complement control module/SCR domain 0.0000341
Further Details:      
 
Domain Number 3 Region: 118-187
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000848
Family Complement control module/SCR domain 0.00015
Further Details:      
 
Domain Number 4 Region: 241-321
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.00000000000187
Family Eukaryotic proteases 0.00016
Further Details:      
 
Domain Number 5 Region: 450-499
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.00000000000389
Family Eukaryotic proteases 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001234   Gene: ENSTTRG00000001313   Transcript: ENSTTRT00000001314
Sequence length 501
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2838:83519:98420:-1 gene:ENSTTRG00000001313 transcript:ENSTTRT00000001314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCSGQVFTARSGVLSSPGYPQPYPKLSSCTYSIRLEEGFRVTLDFMESFDVEMHPETQCP
YDSLKIQTDKEEYGPFCGKTLPRRIETKSNTVTITFATDESGDHTGWKIHYNSTAQPCPD
PTAPPNGHISPVQATYIMKDRFFVFCESGYELLQGYWPLKSFVAVCQTDGSWDQPMPECS
IVDCGPPDDLPSGQVDYITGAEVTIYKAVVKYRCNEFYTMRTDDGKYVCEADGFWTSSKG
EKSPPVCEPVCGISTRTTERRIYGGQNAKLDFPWQALLLGKTVAAALLYDNWILTAAHAV
YEQRGDASSLDIRMGALKRLSPHYTQAWAEAXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXGALVFLHNETQKWFVGGIVSWGSINCGEADQ
YGVYTKVINYIPWIKNIINSF
Download sequence
Identical sequences ENSTTRP00000001234 ENSTTRP00000001234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]