SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001254 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001254
Domain Number 1 Region: 276-372
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.57e-42
Family GDI-like 0.00000701
Further Details:      
 
Domain Number 2 Region: 8-340
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.47e-38
Family GDI-like N domain 0.00000000681
Further Details:      
 
Domain Number 3 Region: 374-419
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.6e-16
Family GDI-like N domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001254   Gene: ENSTTRG00000001334   Transcript: ENSTTRT00000001334
Sequence length 430
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_729:68750:93655:-1 gene:ENSTTRG00000001334 transcript:ENSTTRT00000001334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGAPPASMGRGRDWNVD
LIPKFLMANGQLVKMLLFTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLF
EKRRFRKFLVYVANFDESDPRTFEGIDPKKTAMREVYKKFDLGQDVIDFTGHALALYRTD
DYLDQPCCETINXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSAIYGGTYMLNKPI
EEIIMQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDAN
SCQIIIPQNQVNRKSDIYVCMISSAHNVAAQGKYIAIASTTVETKEPEKEIRPALELLEP
IEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKDIYKRMMGSEFDFEEMK
RKKNDIYGED
Download sequence
Identical sequences ENSTTRP00000001254 ENSTTRP00000001254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]