SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001261 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001261
Domain Number 1 Region: 30-96
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000473
Family Complement control module/SCR domain 0.0000261
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001261   Gene: ENSTTRG00000001341   Transcript: ENSTTRT00000001341
Sequence length 268
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_729:210982:240429:-1 gene:ENSTTRG00000001341 transcript:ENSTTRT00000001341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVSRRLRGCGVGALPALLLLLLGPPATPGITCPTPTSVKHADIWVKSYNLNSRERYVCNS
GFKRKAGTSSLTECVFNKTVNIAHWTTPNLKCIRDPSLTHQRPPSTAAPTGVTPEPDSPN
PSGKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXPGAYQYNPRAVTAAISTSVAVLCGVCVVCLLVRYVRYIRSRQAYQIPSVE
MESMEVVPRTGGTDARGEGTENEPHDLG
Download sequence
Identical sequences ENSTTRP00000001261 ENSTTRP00000001261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]