SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001262 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001262
Domain Number 1 Region: 121-184
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000688
Family Complement control module/SCR domain 0.00012
Further Details:      
 
Domain Number 2 Region: 23-78
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000189
Family Complement control module/SCR domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001262   Gene: ENSTTRG00000001342   Transcript: ENSTTRT00000001342
Sequence length 270
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_729:264750:307110:-1 gene:ENSTTRG00000001342 transcript:ENSTTRT00000001342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPGLLMWGFFVFIVVPGCVTDACLEDPPSLRNAMFKVLRYEVGTMINCDCKKGFRRRSP
FMRCTGNSSHSAWENRCHCDSTXXXXXXKQVTPGLKEQNEETTTEMQSQMQPTGQANLPG
HCKEPPPWEYEHEPLKRIYHFMAGQTVYYQCIQGFRPLQGGPTKSTCKMIYGSMRWTQPK
LECISEGENSQFPGDEEPQESTDAPPGSETDFPLTTNFQTPTEVAATMDMFIFTTEYQIA
VAGCILLLISIFLLTGLTWQQKWKKNRRTI
Download sequence
Identical sequences ENSTTRP00000001262 ENSTTRP00000001262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]