SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001326 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001326
Domain Number 1 Region: 26-532
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.41e-122
Family L-arabinose binding protein-like 0.0000023
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000001326
Domain Number - Region: 780-868
Classification Level Classification E-value
Superfamily Ammonium transporter 0.0418
Family Ammonium transporter 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001326   Gene: ENSTTRG00000001409   Transcript: ENSTTRT00000001409
Sequence length 1091
Comment pep:novel scaffold:turTru1:scaffold_107016:39202:68489:1 gene:ENSTTRG00000001409 transcript:ENSTTRT00000001409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFYSCCWIFLAFTWCTSAYGPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVEC
IRYNFRGFRWLQAMIFAIEEINSSPALLPNMTLGYRIFDTCNTVSKALEATLSFVAQNKI
DSLNLDEFCNCSEHIPSTIAVVGATGSGISTAVANLLGLFYIPQVSYASSSRLLSNKNQF
KSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFS
ELISQYSDEEEIQQVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGRIWLASEAWA
SSSLIAMPEYFHVVGGTIGFALKAGQIPGFREFLQKVHPRKSVHNGFAKEFWEETFNCHL
QEGAKGPLPMDTFLRGHEEGGGRISNSSTAFRPLCTGDENISSVETPYMDYTHLRISYNV
YLAVYSIAHALQDIYTCIPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFD
ECGDLAGNYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKILWSGFSREPLTI
VISVLQVPFSNCSRDCLAGTRKGIIEGEPTCCFECVECPDGEYSDETDASACDKCPDDFW
SNENHTSCIAKEIEFLSWTEPFGIALTLFAVLGIFLTAFVLGVFIKFRNTPIVKATNREL
SYLLLFSLLCCFSSSLFFIGEPQDWTCRLRQPAFGISFVLCISCILVKTNRVLLVFEAKI
PTSFHRKWWGLNLQFLLVFLCTFMQIVICAIWLNTAPPSSYRNHELEDEIIFITCHEGSL
MALGFLIGYTCLLAAICFFFAFKSRKLPENFNEAKFITFSMLIFFIVWISFIPAYASTYG
KFVSAVEVIAILAASFGLLACIFFNKVYIILFKPSRNTIEEVRCSTAAHAFKVAARATLR
RSNVSRQRSSSLGGSTGSTPSSSISSKSNSEDPFPQPERQKQQQPLALTQCAQQPQPRPP
STLQLQQQSQQQPRCKQKVIFGSGTVTFSLSFDEPQKSAMAHRNSTHQNSLEAQKNNDAL
TRHQALLPLQCGETDSELTVQETGLQGPVGGDHQPEMEDPEEMSPALVVSNSRSFVISGG
GSTVTENMLRS
Download sequence
Identical sequences ENSTTRP00000001326 ENSTTRP00000001326 XP_019778890.1.83887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]