SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001344 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001344
Domain Number 1 Region: 7-188
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.09e-31
Family DBL homology domain (DH-domain) 0.00085
Further Details:      
 
Domain Number 2 Region: 188-356
Classification Level Classification E-value
Superfamily PH domain-like 3.94e-24
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001344   Gene: ENSTTRG00000001428   Transcript: ENSTTRT00000001427
Sequence length 378
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3550:45876:108289:1 gene:ENSTTRG00000001428 transcript:ENSTTRT00000001427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIFMNTLKYLQTHDYLLDVDLWRLFANLEELSQTSFGFVSLFHIFKDYVDTSETLPSLDF
ISVLTKYFQGSLCQSHQTYCLNYSAAVFYLESLRQRGDFGIYLKWCEDNEQCRRLHLPEL
LVAPLHRLTRYPLLLKSIWKRSTDSTEKIMIYSIKEKVEKSIWDLEGKVKWLDNFQKCRH
LQEIIVWPPLWDRDKRFFIPECLKHVFKEHMAENILSATNRHLLYEGKLTLAESTRFLDV
YLFLFDDFLLVTKTKRNKKKLGGSDPGLMCPSLIPELQTAIKEGGSCMVLDQPIPLDRLV
VRGLDPLHRSVFGLRNSFLIQHENSYQQCIAAFLLQAQTENIKKTWIAQLTAAISCFTKS
QETKMMSIFTLPAESSEI
Download sequence
Identical sequences ENSTTRP00000001344 ENSTTRP00000001344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]