SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001366 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001366
Domain Number 1 Region: 72-283
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-43
Family DBL homology domain (DH-domain) 0.0004
Further Details:      
 
Domain Number 2 Region: 702-837
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.77e-36
Family BCR-homology GTPase activation domain (BH-domain) 0.0005
Further Details:      
 
Domain Number 3 Region: 299-368,426-460
Classification Level Classification E-value
Superfamily PH domain-like 5.45e-20
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Domain Number 4 Region: 503-609
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000134
Family Synaptotagmin-like (S variant) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001366   Gene: ENSTTRG00000001449   Transcript: ENSTTRT00000001449
Sequence length 851
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2894:81038:211186:-1 gene:ENSTTRG00000001449 transcript:ENSTTRT00000001449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLSHRGLPRLSWIDTLYSNFSYGADDYDGEGNEEQKGPPEGSETMPYIDESPTMSPQL
SARNQGGGDSISPTPPEGLAPGVEAGKGLEMRKLVLSGFLASEEIYINQLEALLLPMKPL
KATATTSQPVLTIQQIETIFYKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLASQ
LGVYKAFVDNYKVALETAEKCSQSNNQFQKISEELKVKGPKDSKDSHTSVTMEALLYKPI
DRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETR
QLVKDGFLVEVSEGSRKLRHVFLFTDVLLCAKLKKTSAGKHQQYDCKWYIPLADLVFPSP
EESEASPQVHPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERLKKKMFENEFLLLL
NSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQKKDLQAFVLSSVELQVLTGSCF
KLRTVHNIPVTSNKDDDESPGLYGFLHVIVHSAKGFKQSANLYCTLEVDSFGYFVSKAKT
RVFRDTTEPKWDEEFEIELEGSQSLRILCYEKCYDKTKVNKDNNEIVDKIMGKGQIQLDP
QTVETKNWHTDVIEMNGIKVEFSMKFTSRDMSLKRTPSKKQTGVFGVKISVVTXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNKDILLMLSDMDINAIAGT
LKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLITFLFLLEHLK
RVAEKEPVNKMSLHNLATVFGPTLLRPSEVESKAHLTSAADIVQVLLYYLQHPPISFAEL
KRNTLYFSTDV
Download sequence
Identical sequences ENSTTRP00000001366 ENSTTRP00000001366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]