SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001391 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001391
Domain Number 1 Region: 396-434,472-575,689-803
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.3e-44
Family Phosphate binding protein-like 0.00015
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000001391
Domain Number - Region: 288-386
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.0011
Family L-arabinose binding protein-like 0.014
Further Details:      
 
Domain Number - Region: 616-665
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0102
Family Voltage-gated potassium channels 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001391   Gene: ENSTTRG00000001475   Transcript: ENSTTRT00000001475
Sequence length 1027
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3283:124797:133587:1 gene:ENSTTRG00000001475 transcript:ENSTTRT00000001475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIVRALWLGLALALGPGPAGGHPHPCGVLARLEGSVRIGDLLPREPDARARAALDRAAL
TPRLPHNLSLELAAAVPPSRDPASLARGLCQALAAPGVTAVLTFPEARPELLQLHFLPAA
TETPVLNVLRRXXXXXXXXXNPFHLQLDWASPLETLLDVLVSVLQAHSWEDVGLVLCRVR
DPGGLVALWTSWAGRAPKLVLDLSRPDPSDAGLRTRLAPLGVPAGGTAPVPVAVLLGCNE
AGARQVLQAAPPGPRWLLGTPLPAKALPTEGLPPGLLALGEVARPPLEAAIHVAVELVAR
ALGSAARVQPERALLPAMINCNDLPLPGPESSGRLLARFLDNTSFRGHTGPVWVTSSSQV
HISRRFRVWSLRRDPRGAPAWATVGWQDGRLESEAGGAAGWPPPPPEARARPKLRVVTLV
EHPFVFAREPDEDGRCPAGQLCLAPGTNDSAALDAHFAALADGSAPRALRRCCYGYCIDL
LERLAEDAPFDFELYIVGDGKYGALRDGRWTGLVGDLLAGRAHMAVTSFSIKSARSQVVD
FTSVFSTSLGIMVRARDTASPIGAFTWPLHWSMWLGVFTALQLTALFLTLYEWRSPFGLT
PRGRNRGTVFYYSSALNLCYAILFGRTVSSKTPKCPTGRLLMNLWAIFCLLVLSSYTANL
AAVMVGDKTFEELSGIHDPKLHHPSQGFRFGTVWESSAEAYVKKSFPEMYAHVRRHSAPT
APHGVAMLTSDPPKLNAFIMDKSLLDYEVSIDADCRLLTVGKPFAIEGYGIGLPRNSPLT
SDLSEFISRYKSSGFIDLLHKWYKMVPCGKRVFAVTEILQMGIYHFSGLFVLLCLGLGSA
LLSSLGEHVFYRLALPRIRRGNKLQYWLHTSQRIHRALSTEPPDRQEEPEPRGLEEPQQG
TLAAPAGLGGWTWVRQASVRECRAHFLLEPAVAAAPDADGDADGPPGLPVWLCSNGRPPA
ELFLGAPRPEELEQLEQRIAGARERLRQALVRRGQLLAQLGDGARHGPRSRLQASEEARG
RPVTRDQ
Download sequence
Identical sequences ENSTTRP00000001391 ENSTTRP00000001391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]