SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001422 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001422
Domain Number 1 Region: 39-236
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 5.7e-59
Family Proteasome subunits 0.00000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001422   Gene: ENSTTRG00000001506   Transcript: ENSTTRT00000001506
Sequence length 237
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2072:217767:218477:1 gene:ENSTTRG00000001506 transcript:ENSTTRT00000001506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALQDVCKWQAPDTQEASPHLPQAGGWALPQGWDPQTFLQIHGPRLAHGTTTLAFRFRHG
VIAAADTRSSCGDYVACPASRKVIPVHQHLLGTTSGTSADCATWYRVLQRELRLRALREG
QLPSVAGAARLLSVMMSRYRGLDLCMATALCGWDRSGPALFYVYSDGTCLQGDIFSVGSG
SPYAYGVLDGGYHYDMSTQEAYALARRAVAHATHRDAYSGGSVDLFHVRESGWEYVS
Download sequence
Identical sequences ENSTTRP00000001422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]