SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001442 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001442
Domain Number 1 Region: 153-228,308-579
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.04e-125
Family Myotubularin-like phosphatases 0.000000206
Further Details:      
 
Domain Number 2 Region: 1119-1195
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.76e-22
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0018
Further Details:      
 
Domain Number 3 Region: 52-132
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000109
Family GRAM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001442   Gene: ENSTTRG00000001529   Transcript: ENSTTRT00000001529
Sequence length 1202
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_496:17853:68899:1 gene:ENSTTRG00000001529 transcript:ENSTTRT00000001529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEETRHSLECIQANQIFPRKQLIREDENLQVPFLELHGESTEYVGRAEDAIIALSNYRL
HIKFKESLVNVPLQLIESVECRDIFQLHLTCKDCKIIRCQFSTFEQCQEWLKRLNNAVRP
PAKIEDLFSFAYHAWCMEVYASEKEQHGDLCRPGEHVTSRFKNEVERMGFDMNNAWRISN
INEKYKLCGSYPQELIVPAWITDKELESVASFRSWKRIPAVVYXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSLSNAS
GAESLAVQPQKLLILDARSYAAAVANRAKGGGCECPEYYPNCEVVFMGMANIHSIRRSFQ
SLRLLCTQMPDPGNWLSALESTKWLHHLSVLLKSALLVVHAVDRDQRPVLAHCSDGWDRT
PQIVALAKLLLDPYYRTIEGFQVLVEMEWLDFGHKFADRCGHGENSDDLNERCPVFLQWL
DCVHQLQRQFPCSFEFNEAFLXXXXXXXXXXXFGTFLCNNAKERGEKHTQERTCSVWSLL
RAGNKAFKNLLYSSQSEAVLYPVCHVRNLMLWSAVYLPCPSPSTPVDDSCAPYPAPGTSP
DDTPLSRLPKTRSFDNLTTACENTVPLASRRSSDPSLNEKWQEHRRSLELSTLAGPGEEL
LDPDSLGKPAKVLGGAELSVAAGVAEGQMENILQEATKEESGVEEPAHREMQEVKEEALL
EEGSRGKTPECPAIVLHQEPELGDAALRSHHPGTSLLVLSQGILEQQGGHSILPSSLQEP
PPGEDAQEVPVEQSRIGAITQDREEAVLPISVDVKVGFGTSQSSSLPSQVSFETRGPNAD
SSMDMLVEDKVKSESGPQGHDRPCLPARVSSGRFSGKEELPQAMEPRPSERSLAERPQVG
SLVYRTSPSSTQSPAHSPCALPLAECKEGLVCNGAPETENKASEQLPGHSTLQKYPTPNG
HCANGETGRSKDSLSRQLSATSCSSAHLHSRNLHHKWLHSHSGRASATGSPDQPSRSHLD
DDGMPLYTDTIQQRLRQIESGHQQEVETLKKQVQELRSRLESQYLTSSLRFNGDFGDEVT
SIPDSESILDQNCLSRCSTEIFSEASWEQVDKQDTEMTRWLPDHLAAHCYACDSAFWLAS
RKHHCRNCGNVFCSSCCNQKVPVPSQQLFEPSRVCKSCYSSLHPTSSSIDLELDKPIAAT
SN
Download sequence
Identical sequences ENSTTRP00000001442 ENSTTRP00000001442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]