SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001517 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001517
Domain Number 1 Region: 28-189
Classification Level Classification E-value
Superfamily N-acetylmuramoyl-L-alanine amidase-like 4.71e-44
Family N-acetylmuramoyl-L-alanine amidase-like 0.000000429
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001517   Gene: ENSTTRG00000001610   Transcript: ENSTTRT00000001610
Sequence length 190
Comment pep:known_by_projection scaffold:turTru1:scaffold_99611:90495:94486:1 gene:ENSTTRG00000001610 transcript:ENSTTRT00000001610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRRCALLAWALSGLLSLGAAQEASVSCIPIVPRREWKARASERNQRDGPVRYAVVSHAA
GSAWDTPSSCLKIQNVQHYHVRTLGWCGVGYDFLMGEDRLQYEGRGWNTLGAHSGPTNPI
SLGISFMGNYVDRVPLPRAIRAAQSLLPCGVAQGFLTPSYEVKGHRDVQTFSPGYQLYEI
IQQWSHYHRV
Download sequence
Identical sequences ENSTTRP00000001517 ENSTTRP00000001517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]