SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001527 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001527
Domain Number 1 Region: 147-266
Classification Level Classification E-value
Superfamily PH domain-like 1.71e-31
Family Pleckstrin-homology domain (PH domain) 0.0057
Further Details:      
 
Domain Number 2 Region: 10-84
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00000000000131
Family DBL homology domain (DH-domain) 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001527   Gene: ENSTTRG00000001620   Transcript: ENSTTRT00000001620
Sequence length 1084
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1175:4387:20041:1 gene:ENSTTRG00000001620 transcript:ENSTTRT00000001620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRASVAPAHKLSYVGRVVREIVETERTYVQDLRSIVESQEFDIYTQYCNNYPNSVAALTE
CMQDKQQAKFFRDRQELLQHSLPLGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXQVRLQEIQSLLINWKGPDLTTYGELVLEGTFRVHRV
RNEKTFFLFDKALLITKKRGDHFVYKGHIPCSSLMLIESTRESPCFTVTHYKHSKQQYNI
QAKTVEEKRSWTHHIKRLILENHHTTIPQKAKEAILEMDSYYPNRYRHSPERLKKASQDE
ASTHVHQGRRQSEPSRHLLRQHSEKARAAGMKGKGHREPEDPKSCRRPSSRSPTTAEKCL
SFESVSSLPEVEPDPESGTEQEESAAMEGPRTEEMPSDTEAPEVLEMQLDTHQLLLGLDP
PGDVVDFMVADSTEDPKVLSSEDEEEEVGAAHEPESLLPPSVLDQASVIAERFVSSFSRR
SSLALEDGKASGFGTPRLTSRSSSVVSLEDSEKGLARRGSTTDPLGSQLPPEADISMGVA
AESDPSVNGTETQSPGCPAEPDRPSCTKESKLSSRDRLLLDKIKSYYESAEHHDAGFSVR
RRESLSFIPKGLVRNSVSRINSLPRPDPEPVAPPGHKRQVGSRAASWALFDYPGPGQARA
GDPAPITDAEFRPSSEIVKIWEEMESPEGSPGKGPGQGQANSFDLHEPLFILEERELGAI
TEESAAASPDRASPTEPPSPAHLARELKELVKELSSGTQGELVTPLHPRILQLSHVMDSH
VSERVKSKVHQLARQYSLRIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSGKVGR
CCSLNARRAPAGPGVAQPQPLAGSSPSAPDGGEALYVTADLTLEDSRRMVIMEKGPLSGP
NAGLEAASGQGPSSPAAQAGQGPAFQECAEYRPKEEGPRDLADPSQQGRVRSLREKFQAL
NSTG
Download sequence
Identical sequences ENSTTRP00000001527 ENSTTRP00000001527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]