SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001563 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001563
Domain Number 1 Region: 631-913
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.45e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000762
Further Details:      
 
Domain Number 2 Region: 215-361
Classification Level Classification E-value
Superfamily PH domain-like 5.23e-40
Family Third domain of FERM 0.00011
Further Details:      
 
Domain Number 3 Region: 113-217
Classification Level Classification E-value
Superfamily Second domain of FERM 3.01e-37
Family Second domain of FERM 0.0000764
Further Details:      
 
Domain Number 4 Region: 29-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.61e-23
Family First domain of FERM 0.001
Further Details:      
 
Domain Number 5 Region: 510-604
Classification Level Classification E-value
Superfamily PDZ domain-like 2.13e-21
Family PDZ domain 0.0000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001563   Gene: ENSTTRG00000001658   Transcript: ENSTTRT00000001658
Sequence length 926
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_406:5188:151745:1 gene:ENSTTRG00000001658 transcript:ENSTTRT00000001658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRFRLPAGRTYNVRASELARDRLHTEVVCNILLLDNTVQAFKVNKHDQGQVLLEMVFR
HLDLTERDYFGLQLADDCTDNPRWLDPNKPIRKQLKRGSPYSLNFRVKFFVSDPNKLQEE
YTRYQYFLQIKQDILTGRLPCPYNTAALLASLAVQSELGDYNQSENLPGYLSDYSFIPNQ
PQDFEKEIAKLHQQHTGLSPAEAEFNYLNTARTLELYGVEFHYARDQSNNEIMIGVMSGG
ILIYKNKVRMNTFPWLKIVKISFKCKQFFIQLRKELHESRETLLGFNMVNYRACKNLWKA
CVEHHTFFRLDRPLPPQKNFFAHYFTLGSKFRYCGRTEVQSVQYGKEKANKDRVFARSPS
KPLARKLMDWEVVSRNSLSDDRLETQSLPSRSPPGTPNHRNSAFTQEGTRLRPSSVGHLV
GHVVHTCPGEAFARHRSPSSTQANSIVLESSPSQETPGDGQPPALPPKQSKKNSWNQIHF
SHSQQDLENHINETFDVPSSPEKATPNGGIPHDNLVLIRMKPDENGRFGFNVKGGCDQKM
PVIVSRVAPGTPADLCVPRLNEGDQVVLINGRDVAGHTHDQVVLLIRASCETHPGELVLL
VRPNAVYDVVEEKLENEPDFQYIPEKAPLDSIHQDGHSLRESMVQLAAGLITGTVLTQFD
QLYRKKPGMTMSCAKLPQNISKNRYRDISPYDATRVILKGKEDYINANYINMEIPSSRII
NQYIACQGPLPHTCTDFWQMAWEQGCSTVVMLTTQAEHGRVKCHQYWPEPTGSSSYGCYQ
VTCHSEEGNTAYVFRKMTLFNQEKNESRQLTQIQYIAWPDHGVPDDSSDFLDFVCHVRNK
RAGKEEPIVVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTPSQ
YRFVCEAILKVYEEGFVKPLTTSSNK
Download sequence
Identical sequences XP_019787882.1.83887 ENSTTRP00000001563 ENSTTRP00000001563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]