SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001578 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001578
Domain Number 1 Region: 292-446
Classification Level Classification E-value
Superfamily PH domain-like 6.43e-48
Family Pleckstrin-homology domain (PH domain) 0.0000000535
Further Details:      
 
Domain Number 2 Region: 94-135,179-302
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.35e-40
Family DBL homology domain (DH-domain) 0.000000143
Further Details:      
 
Domain Number 3 Region: 10-110
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000171
Family SH3-domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001578   Gene: ENSTTRG00000001674   Transcript: ENSTTRT00000001673
Sequence length 515
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1252:30634:193157:-1 gene:ENSTTRG00000001674 transcript:ENSTTRT00000001673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FITLITGDSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKLWWGQIDDEEGWFPASF
VRLWVNQEDGVEEGPSDVQNGHLDPNSDCLCLGRPLQNRDQMRANVINEIMSTERHYIKH
LKDICEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPHLSEIG
PCFLEHQDGFWIYSEYCNNHLDACMELSKLMKDSRYQHFFEACRLLQQMIDIAIDGFLLT
PVQKICKYPLQLAELLKYTAQDHSDYRYVAAALAVMRNVTQQINERKRRLENIDKIAQWQ
ASVLDWEGEDILDRSSELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLCKKDLIRRDILY
YKGRIDMDKYEVVDIEDGRDDDFNVSMKNAFKLHNKETEEIHLFFAKKLEEKIRWLRAFR
EERKMVQEDEKIGFEISENQKRQAAMTVRKVPKQKGVTSARSVPPSYPPPQDPLNQGQYL
VPDGIAQSQVFEFTEPKRSQSPFWQNFSRLTPFKK
Download sequence
Identical sequences ENSTTRP00000001578 ENSTTRP00000001578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]