SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001592 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001592
Domain Number 1 Region: 112-172,287-370
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.23e-33
Family Regulator of G-protein signaling, RGS 0.0073
Further Details:      
 
Domain Number 2 Region: 366-498
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.5e-17
Family Regulator of G-protein signaling, RGS 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001592   Gene: ENSTTRG00000001683   Transcript: ENSTTRT00000001687
Sequence length 650
Comment pep:known_by_projection scaffold:turTru1:scaffold_116139:17196:70272:1 gene:ENSTTRG00000001683 transcript:ENSTTRT00000001687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGAGPYPRQSPRALRPDPGPAMSFFRRKVKGKEQEKTSDVKSGKASISVHSPQKSTKNH
ALLEAAGPSHVAINAISANMDSFSSSRTATLKKQPSHMEAAHFGDLGRSCLDYQTQETKS
SLSKTLEQVLHDTVVLPYFIQFMELRRMEHLVKFWLEAESFHSTTWSRIRAHSLNTVKQS
SLAEPVSPSKKHETTAAFVTDSLDKRVEDSSLAQLEGIDLNNRTSNTQNHLLLSQECDSA
HSLHLEMARTGAHRGSVETQESSRLIVASRNSPSSPLKELSGKLMKSIEQDAVNTFTKYI
SPDAAKPIPITEAMRNDIVAKICGEDGQVDPNCFVSAQSIVFSAMEHEHFSEFLRSHHFC
KYQIEVLTSGTVYLADILFCESALFYFSEYMEKEDAVNILQFWLAADNFQSQLAAKKGQY
DGQEAQNDAMILYDXXXXXXXXXXLFDDVREISNICREGSLPNCFITPLRQAWTMEKVFL
PGFLSSNLYYKYLNDLIHSVRGDEFLGGGVLLTALGSAGPTEDSHPGSADSSAVQSSVKK
ASVKILKNFDEAIIVDAASLDPESLYQRTYAGKTTFGRVSDLGQFIRESEPEPDVKKSKG
SMFSQAMKKWVQGNTDEAQEELAWKIAKMIVSDVMQQAQCDQPLEKSTKL
Download sequence
Identical sequences ENSTTRP00000001592 ENSTTRP00000001592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]