SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001594 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001594
Domain Number 1 Region: 7-116
Classification Level Classification E-value
Superfamily SRP19 5.49e-36
Family SRP19 0.000000688
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001594   Gene: ENSTTRG00000001690   Transcript: ENSTTRT00000001689
Sequence length 142
Comment pep:novel genescaffold:turTru1:GeneScaffold_1370:100474:106513:1 gene:ENSTTRG00000001690 transcript:ENSTTRT00000001689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPIAVENPTATEIQDVCSAVGLNVFL
EKNKMYSREWNRDLQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQKT
GGGDQSLQQGEGSKKGKGKKKK
Download sequence
Identical sequences ENSTTRP00000001594 ENSTTRP00000001594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]