SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001673 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001673
Domain Number 1 Region: 56-394
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.56e-74
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000197
Further Details:      
 
Domain Number 2 Region: 408-503
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 7.85e-20
Family Anticodon-binding domain of Class II aaRS 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001673   Gene: ENSTTRG00000001771   Transcript: ENSTTRT00000001772
Sequence length 506
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3060:17687:24467:1 gene:ENSTTRG00000001771 transcript:ENSTTRT00000001772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQLGLLHGRAWAVLFGQLRRPPGAVCIRAVHSHSQVAEAALATQLKPHQEKSNFIIKTP
KGTRDLSPEQMVVREKILDMVVSCFKRHGAKGLDTPAFELKEMLTEKYGEDSGLVYDLKD
QGGELLSLRYDLTVPFARYLAMNKVKKMKRYHVGKVWRRESPTIAQGRYREFCQCDFDIA
GQFDPMIPDAECLKIMCEILSGLQLGDFLIKVNDRRILDGIFAVCGVPESKFHAICSSVD
KLDKMSWKDVRHEMVAKKGLAAEVADRIWDYVQCHGGVSLVQQMFQDPRLSQNKQALEGL
GDLKLLFEYLTLFGIAEKISFDLSLARGLDYYTGVIYEAVLLQTPAHAEEEPRNVGSVAA
GGRYDGLVGMFDPKGHNVPCVGLSIGVERIFSIVEQRMKTFGEKIRTTETQVFVATPQKN
FLQERLKLIAELWDAGIKAELMYKNNPKLLTQLHYCENTGIPLVVIIGEQELKEGVIKLR
SVANREEVAITRENLVAEIQKRLSES
Download sequence
Identical sequences ENSTTRP00000001673 ENSTTRP00000001673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]