SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001715 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001715
Domain Number 1 Region: 156-340
Classification Level Classification E-value
Superfamily E set domains 3.36e-65
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000102
Further Details:      
 
Domain Number 2 Region: 47-170
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1e-18
Family Voltage-gated potassium channels 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001715   Gene: ENSTTRG00000001823   Transcript: ENSTTRT00000001822
Sequence length 379
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2156:301666:302805:-1 gene:ENSTTRG00000001823 transcript:ENSTTRT00000001822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSVAKVYYSQTTQTESRPLMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFI
DMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELGPPANHTPCVVQVHTLTGAFL
FSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIR
FSQHAVVAAHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQV
DTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSY
LPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDTSVRYRDPEKLKLEES
LREQDEKEGSAISVRISNV
Download sequence
Identical sequences ENSTTRP00000001715 XP_004284502.1.21590 XP_007461341.1.90284 ENSTTRP00000001715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]