SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001761 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001761
Domain Number 1 Region: 149-493
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.42e-83
Family Protein kinases, catalytic subunit 0.0000000000133
Further Details:      
 
Domain Number 2 Region: 2-146
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.56e-39
Family Regulator of G-protein signaling, RGS 0.0000000673
Further Details:      
 
Domain Number 3 Region: 516-626
Classification Level Classification E-value
Superfamily PH domain-like 8.77e-27
Family Pleckstrin-homology domain (PH domain) 0.00000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001761   Gene: ENSTTRG00000001878   Transcript: ENSTTRT00000001878
Sequence length 651
Comment pep:novel genescaffold:turTru1:GeneScaffold_2776:299020:306768:1 gene:ENSTTRG00000001878 transcript:ENSTTRT00000001878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRSVMQKYLEDRGEVTFEKVFSQKLGYLLFRDFCLKHLEEAKPLVEFYEGIKKYEKLETE
EERLACSREIFDTYIMKELLACSHPFSKSAIEHVQGHLAKKQVPPDLFQPYIEEICQNLR
GDVFQKFIESDKFTRFCQWKNVELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYA
MKCLDKKRIKMKQGETLALNERIMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGD
LHYHLSQHGVFSEADMRFYAAEIILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGL
ACDFSKKKPHASVGTHGYMAPEVLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKD
KHEIDRMTLTMAVELPDSFSPELRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDW
QMVFLQKYXXXXXXXXXXXXXXXXXXXXXXXXXXXKGIKLLDSDQELYRNFPLTISERWQ
QEVAETVFDTINAETDRLEARKKTKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQR
RYFYLFPNRLEWRGEGEAPQSLLTMEEIQSVEETQIKERKCLLLKIRGGKQFVLQCDSDP
ELVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGL
Download sequence
Identical sequences ENSTTRP00000001761 ENSTTRP00000001761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]