SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001793 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001793
Domain Number 1 Region: 94-358
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.2e-57
Family Eukaryotic proteases 0.0001
Further Details:      
 
Domain Number 2 Region: 46-107
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000178
Family Complement control module/SCR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001793   Gene: ENSTTRG00000001911   Transcript: ENSTTRT00000001911
Sequence length 359
Comment pep:novel genescaffold:turTru1:GeneScaffold_588:174435:179240:1 gene:ENSTTRG00000001911 transcript:ENSTTRT00000001911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPHSTAVSEADVPKMSALQAVVALLLCGQLFAVQTSETTTATDDSCLKPPEIANGYLEHL
VRYRCKTYYKLRTGDGVYTLNTEKQWINKDLGEQLPECEAVCGKPKHPAVQVQRIIGGSL
DAKGSFPWQAKMVSRNNLTSGATLINEQWLLTTAKNLFLGHDNTTKAKDIAPTLRLYVGR
KQLVEIEKVLLHPDYSEVDIGLIKLREKVPIDETVMPICLPSKDYVEAGRVGYVSGWGQN
ANLVFTEHLKYIMLPVADQDKCVQHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGLSKYQ
EDTCYGDAGSAFAIHDEADDTWYAAGILSFDKSCATAEYGVYVKVSSTLDWVQKTIADN
Download sequence
Identical sequences ENSTTRP00000001793 ENSTTRP00000001793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]