SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001842 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTTRP00000001842
Domain Number - Region: 264-484
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00377
Family Voltage-gated potassium channels 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001842   Gene: ENSTTRG00000001963   Transcript: ENSTTRT00000001963
Sequence length 540
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2693:128201:172607:-1 gene:ENSTTRG00000001963 transcript:ENSTTRT00000001963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DAMAHLDSEVTEECLREDLKFYFMNPCEKFRARQQIPWKMGLQILKIVMVTTQLVRFGLS
NQLVVAFKEENTVAFKHLFLKGYSGVDEDEYSCSVYTQEDTYESIFFAISQFHRLRNLSL
GTLGYGKNEDNRIGLKVCKQHYKKGTMFPSNETLNIDSDIEIDCIHLDLQTLSKNPQDWK
NSSFFRLAFYRLLQVEISFHLKGIDLQTIHSRELPDCYIFQNTIIFDNKAHSGKIKIYFD
SDANIEECKDLNISGSIQKNTQYVLVFDAFVIVICLASLILCTRSIVLGLRLRKRFLNFF
LEKYKRCVCNADQWEFINRWYILVIVSDLMSIIGSILKMEIKAKNLTNYDLCSILLGTST
LFVWVGVIRYLGYFQAYNVLILTMQASLPKVLRFCACAGMIYLGYTFCGWIVLGPYHDKF
ENLNTVAECLFSLVNGDDMYATFAHIQQKSLLVWLFSRLYLYSFISLFIYMILSLFIAII
TDSYDTIKKYQQNGFPATDLQEFLKECGSKEKCQKESSAFLSCICCLRRNGSDDHLMLIN
Download sequence
Identical sequences ENSTTRP00000001842 ENSTTRP00000001842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]