SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001846 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001846
Domain Number 1 Region: 84-315
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-53
Family DBL homology domain (DH-domain) 0.00024
Further Details:      
 
Domain Number 2 Region: 299-383,415-461
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-20
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 3 Region: 578-672
Classification Level Classification E-value
Superfamily PH domain-like 8.22e-20
Family Pleckstrin-homology domain (PH domain) 0.0022
Further Details:      
 
Domain Number 4 Region: 492-551
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.58e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001846   Gene: ENSTTRG00000001967   Transcript: ENSTTRT00000001967
Sequence length 687
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2381:55569:79995:1 gene:ENSTTRG00000001967 transcript:ENSTTRT00000001967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGASKEKLSSVSSLATAFENIRTPGAAPRVHGLEAGHHHPGCRPPSPTGPWDKPTVEEA
VDSGPRTVSRRYLSSLKNKLSSRDWRKSCQARTCPGPGTQEPEEKRIVQELLETEQAYVA
RLHLLDQAMTQLRLVFFQELLKEARSSKAFPEDVVRLIFSNTASIYQFHAQFFLPELQQR
LDNWTTTPRIGDVIQKLAPFLKMYSEYVKNFERAAELLATWSDKSPPFQEVITRIQSSEA
SGSLTLQHHMLEPVQRIPRYELLLKEYVQKLPAQAPDLADAQKALDMIFSAAQHSNAAIT
EMERLQELWEVYQRLGLEDDLVDPSNTLLREGPVLKISFRRIGPMERYLFLFNNMLLYCV
PRVIQVGAQFQVRTRIDVASMKMYSNLFSQSSTDRHLDCSLLSVSANETAVNNCRRLTDA
ELHFLWSGKQRTLLRARSQEEMISWLQACQAAIDQIEKRNETFKAAVQSPEGDTQEQEXX
XEELGLRAQWVRDMVTMCMRCQEPFNLMRRRHHCRCGYVVCARCSDYRAELKYDDNRPSR
VCLDCYTFLTGNVLPEDKEDKRRGILEKGAAAGSEQSLMCSFLQLFGDKWGKSGSRGWCV
IPRDDPLVLYVYAAPQDMRAHTSIPLLGYQVTAGPQADPRVFQLQQSGQLYTFKAETEEL
KDRWVKAMERAASSLSPGGPNDRDLSD
Download sequence
Identical sequences ENSTTRP00000001846 ENSTTRP00000001846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]