SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001918 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001918
Domain Number 1 Region: 3-46
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000017
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001918   Gene: ENSTTRG00000002042   Transcript: ENSTTRT00000002042
Sequence length 112
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2601:233:51349:-1 gene:ENSTTRG00000002042 transcript:ENSTTRT00000002042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HEEPCGPSHRSFCLNGGICYVIPTIPSPFCRCIENYTGARCEEVFLPSSSIQTKSDLFAA
FVALAVLLGTLIIGALYFLCRKGHLQRASSIQYDISLVETSSTSVHHSHGEH
Download sequence
Identical sequences ENSTTRP00000001918 ENSTTRP00000001918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]