SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000001936 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000001936
Domain Number 1 Region: 26-322
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3.67e-74
Family Gamma-glutamyltranspeptidase-like 0.0000917
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000001936   Gene: ENSTTRG00000002060   Transcript: ENSTTRT00000002060
Sequence length 550
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3218:279173:298561:-1 gene:ENSTTRG00000002060 transcript:ENSTTRT00000002060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGHGATVSMVLLGLGLALAIIVPIVVVSWHRVHCGPQAFAHAAVAADSKICSDIGRAI
LQQHGSPMDATIAALVCTGVVNPQSMGLGGGVIFTIYNASTGKVEVINARETVPASHVPG
LLDQCKQAQPLGTGAQWIGVPGELRGYAEAHHRHGHLPWAQLFRPTIALLRGGLRVPRIL
SRFLHSSYLRPSLHASSLRQLFFNGTEPLSPHDPLPWPALAATLETVAAEGADALYTGRL
GQMLLEDVAKEGSLLTPQDLASFRPEVVDALEMPLGDYTLYSPPPPAGGAILSFVLNVLK
GFNFSAESVARPEGRVNLYHHLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXE
VKKGLQYRGQ
Download sequence
Identical sequences ENSTTRP00000001936 ENSTTRP00000001936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]