SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002028 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002028
Domain Number 1 Region: 415-530
Classification Level Classification E-value
Superfamily CBS-domain pair 0.000000000531
Family CBS-domain pair 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002028   Gene: ENSTTRG00000002161   Transcript: ENSTTRT00000002161
Sequence length 948
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1035:27887:72617:1 gene:ENSTTRG00000002161 transcript:ENSTTRT00000002161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAAAVGVRLRDCCSRGAVLLLFFSLSPRPPTAAAWLLGLRPEDTAGGRVSLEGGTLR
AAEGTSFLLRVYFQPGPAAPVEPVPTPPLSPGENGTGDWAPRLVFIEEPPGGSGAAPSAV
PTRPPGSQRCREQSDWASDVEVLGPLRPGGVAGSALVQVRVRELRKGEAERGGTSGGGKL
FSLCAWDGRAWHHHGAAGGFLLRVRPRLYGPGGDLLPPAWLRALGAFLLLALSALFSGLR
LSLLSLDPVELRVLRNSGSAAEQEQARRVQAVRGRGTHLLCTLLLGQAGANAALAGWLCA
SLPPGVGDTGEDYGDAGTHFPWLPALVCTGAVFLGAEICPYSVCSRHGLAIASHSVCLTR
LLMAAAFPVCYPLSRLLDWALRQEISTFYTREKLLETLRAADPYSDLVKEELTIIQGALE
LRTKVVEEVLTPLGDCFMLRSDAVLDFATVSEILRSGYTRIPVYEGDQRHNIVDILFVKD
LAFVDPDDCTPLLTVTRFYNRPLHCVFNDTRLDTVLEEFKKGKSHLAIVQRVNNEGEGDP
FXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNRKKQRVPHRERKRHDFSLFKLSDSEMRV
KISPQLLLATHRFMATXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXGKVEVEVGKEGLRFENGAFTYYGVPAIMTTACSDNDVRKVGSLAGSS
VLLNRSPSRCSGLNRSESPSRERSDFGGSNTQLCSSSNNLYTPDYSVHILSDVQFVKITR
QQYQNALTACRMDSSPQSPDVEAFTDGESTKAPMTRGTPQTPKDDAAVTLLSNRNSLPCS
RSDGLRSPSEVMYLRMEEMAFTQEEMTDFEGQSTQQLSLSPAAVPMRAASDSECCHINLD
TETSRCSSSFEETMGQKLLRTLSGQKRKRSPDGERTSEENSNLTPLIT
Download sequence
Identical sequences ENSTTRP00000002028 ENSTTRP00000002028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]