SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002091 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002091
Domain Number 1 Region: 105-255
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.45e-16
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 2 Region: 340-502
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.000000000866
Family Potassium channel NAD-binding domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002091   Gene: ENSTTRG00000002198   Transcript: ENSTTRT00000002231
Sequence length 1173
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2091:36024:721133:-1 gene:ENSTTRG00000002198 transcript:ENSTTRT00000002231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAFIIPVTKEVPCDSRGQRMWAFLAYTMVTFFGSLFIILWRTLMYLWDVCCHCGGKTKE
AQKINNGSSQADGTLKPVDEKEEAVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFAL
SIGALVIYFIDSSNPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLEVN
SVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLSIF
ISTWLTAAGFIHLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFLKD
FLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADAC
LILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDD
AICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNEMYTEYLS
SAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRDMPSILINPGNHLKIQEGTLGFFI
ASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRPKMSIYKRMRRACCFDCGRSERDCSC
MSGRVRGNVDTLERAFPLSSVSVHDCSTTFRAFEDEQPSTLSPKKKQRNGGMRNSPSSSP
KLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTVLSGHVV
VCIFGDVTSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFPKVSILP
GTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDDSIGVLQ
ANSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDTNVQFLDQDDDDDPD
TELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIAEENALR
GGYSTPQTLANRDRCRVAQLALLDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDA
HLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAGQSRASLSHSSHSSQSSSKKS
SSVHSIPSTANRQNRPKSRESRDKQKYVQEERL
Download sequence
Identical sequences ENSTTRP00000002091 ENSTTRP00000002091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]