SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002100 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002100
Domain Number 1 Region: 238-561
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.97e-137
Family Myotubularin-like phosphatases 0.000000000142
Further Details:      
 
Domain Number 2 Region: 97-210
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-36
Family GRAM domain 0.0000284
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002100   Gene: ENSTTRG00000002239   Transcript: ENSTTRT00000002240
Sequence length 561
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2675:139877:303166:1 gene:ENSTTRG00000002239 transcript:ENSTTRT00000002240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRPATTTAASRCGDGLDPGPADDRRPPWVVEAPAAGSRQPSVETLDSPTGSHVEWCKQL
IAATISSQISGSVTSENVSRDYKALRDGNKLAQMEEAPLFPGESIKAIVKDVMYICPFVG
AVSGTLTVTDFKMYFKNVERDPHFVLDVPLGVISRVEKIGVQSHGDNSCGIEIMCKDMRN
LRLAYKQEEQSKLGIFDNLNKHAFPLSNGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXGL
PNESWKISKVNSNYELCDTYPAIIVVPTSVKDDDLSKVAAFRAKGRIPVLSWIHPESQAT
ITRCSQPLVGPNDKRCKEDEKYLQTIMDANAQAHKLIIFDARQNKVASTNKAKGGGYESE
SAYPNAELVFLEIHNIHVMRESLRKLKEIAYPAIEEARWLSNVDGTHWLEYIRMLLAGAV
RIADKIESGKTSVVVHCSDGWDRTSQLTSLAMLMLDSYYRTIKGFEALIEKEWISFGHRF
ALRVGHGNDNHADADRSPIFLQFIDCVWQMTRQFPSAFEFNELFLITILDHLYSCLFGTF
LCNCEQQRLKEDVYTKTISLW
Download sequence
Identical sequences ENSTTRP00000002100 ENSTTRP00000002100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]