SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002120 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002120
Domain Number 1 Region: 1484-1592
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.16e-35
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 2 Region: 786-900
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-33
Family Spermadhesin, CUB domain 0.00078
Further Details:      
 
Domain Number 3 Region: 1830-1949
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.9e-32
Family Spermadhesin, CUB domain 0.00061
Further Details:      
 
Domain Number 4 Region: 622-726
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-31
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 5 Region: 2014-2116
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.98e-31
Family Spermadhesin, CUB domain 0.0006
Further Details:      
 
Domain Number 6 Region: 242-344
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.1e-30
Family Spermadhesin, CUB domain 0.00075
Further Details:      
 
Domain Number 7 Region: 2179-2286
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-26
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 8 Region: 1304-1425
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-26
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 9 Region: 2359-2463
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.02e-26
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 10 Region: 958-1079
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.54e-26
Family Spermadhesin, CUB domain 0.0022
Further Details:      
 
Domain Number 11 Region: 1137-1246
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.8e-26
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 12 Region: 1652-1767
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-24
Family Spermadhesin, CUB domain 0.0048
Further Details:      
 
Domain Number 13 Region: 73-173
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.98e-22
Family Spermadhesin, CUB domain 0.00092
Further Details:      
 
Domain Number 14 Region: 2739-2807
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.27e-18
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 15 Region: 3095-3166
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.56e-18
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 16 Region: 3155-3224
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.85e-18
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 17 Region: 2979-3047
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.18e-17
Family Complement control module/SCR domain 0.00074
Further Details:      
 
Domain Number 18 Region: 2796-2863
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.48e-17
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 19 Region: 382-454
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000111
Family Complement control module/SCR domain 0.00093
Further Details:      
 
Domain Number 20 Region: 3036-3106
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000115
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 21 Region: 445-555
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000275
Family Spermadhesin, CUB domain 0.0045
Further Details:      
 
Domain Number 22 Region: 2121-2189
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000944
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 23 Region: 2648-2710
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000122
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 24 Region: 178-239
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000256
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 25 Region: 1948-2010
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000351
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 26 Region: 2856-2923
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000514
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 27 Region: 3275-3332
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000113
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 28 Region: 2912-2972
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000167
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 29 Region: 906-966
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000236
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 30 Region: 1424-1487
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000256
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 31 Region: 3207-3269
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000306
Family Complement control module/SCR domain 0.00077
Further Details:      
 
Domain Number 32 Region: 1597-1664
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000089
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 33 Region: 1249-1312
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000139
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 34 Region: 1774-1837
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000175
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 35 Region: 560-622
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000264
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 36 Region: 2291-2355
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000032
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 37 Region: 731-799
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000005
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 38 Region: 1079-1141
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000105
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 39 Region: 2465-2525
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000473
Family Complement control module/SCR domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002120   Gene: ENSTTRG00000002221   Transcript: ENSTTRT00000002262
Sequence length 3632
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1081:59236:690063:-1 gene:ENSTTRG00000002221 transcript:ENSTTRT00000002262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSRGRKQGRCGCPAGRARTEAGISALVPGAGSRWGRPPTPPPPPPPLLLLLGWGLLST
SAAAXXXXXXXXQGPNGTGESPGFPYGYPNYANCTWTITAEDQHRIQLVFQFALEEDFDV
LSVFDGPPQPELRIRLTGFQLPATVVSAATTLSLRLISDYAVSAQGFHASYEALPSHTCG
NPGRLPNGVQQGSTFNLGDKVRYSCNPGFFLEGHAVLTCHAGSENSATWDFPLPSCRADD
ACGGTLRGQSGIISSPHFPSEYHNNADCTWTILAELGDTIALVFIDFQLEDGYDFLEVTG
TEGSSLWFTGASLPAPVISSKNWLRLHFTSDGNHRQRGFSAQYQVKKQIELKSRGVKLMP
SKDNSQKTSVLTQVGVSQGHNMCPDPGIPERGKRLGSDFRLGSSVQFTCNEGYDLQGSKR
ITCMKVSDMFAAWSDHRPVCRARMCDAHLRGPSGIITSPNFPIQYDNNAHCVWIITALNP
AKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLTGTSVPDLIVSTNHQMWLLFQT
DSSGSSLGFKASYEEIEQGSCGDPGIPAYGWREGSWFRHGDTLQFECQPAFELVGQKAIT
CQKNNQWSAKKPGCVFSCFFNFTSPSGVVLSPNYPEDYGNHLHCVWLILARPESRIHLAF
NDIDVEPQFDFLVIKDGATAEAPVLGTFSGNQLPSSITSSGHVARLEFQTDHSTGKRGFN
ITFTTFRHNECPDPGVPVNGKRFGDSLQLGSSISFLCDEGFLGTQGSETITCILKEGSVV
WNSAVLRCEAPCGGHLTSPSGTILSPGWPGFYKDALSCAWVIEAQPGYPIKITFDRFKTE
VNYDTLEVRDGRTYSAPLIGVYHGTQVPQFLISTSNYLYLLFSTDKSHSDIGFQLRYETI
TLQSDHCLDPGIPVNGQRHGNDFYVGALVTFSCDSGYTLSDGEPLECEPNFQWSRALPSC
EALCGGFIQGSSGTILSPGFPDFYPNNLNCTWIIETSHGKGVFFTFHTFHLESSHDYLLI
TENGSFTQPLRQLSGSRLPAPISAGLYGNFTAQVRFISDFSMSYEGFNITFSEYDLEPCE
EPEVPAYSIRKGLQFGVGDTLTFSCFPGYRLEGTARITCLGGRRRLWSSPLPRCVAECGN
SVTGTQGTLLSPNFPVNYSNNHECIYSIQTQPGKGIQLKARAFELSEGDVLKVYDGNNNS
ARLLGVFSRSEMLGVTLNSTSSSLWLDFISDAENTSKGFELQFSSFELIKCEDPGTPQFG
YKVRDGGHFAGSSVSFGCDPGYSLRGSEALLCLSGERRTWDRPLPTCVAECGGTVKGEES
GQVLSPGYPAPYEHNLNCIWTIEASAGCTIGLHFLVFDTEELHDVLRIWDGPVENGVLLK
ELSGPALPKDLHSTFSLVVLQFSTDFFTSKQGFAIQFSVSTATSCNDPGVPQNGSRSGDS
WEAGDSTVFQCDPGYALQGSAEISCVKIENRFFWQPSPPTCIAPCGGDLTGPSGVILSPN
YPEPYPPGKECDWKVTVSPDYVIALVFNIFNLEPGYDFLHIYDGRDSLSPLIGSFYGSQL
PGRIESSSNSLFLAFRSDASVSNAGFVIDYTENPRESCFDPGPIKNGTRVGSDLKLGSSI
TYYCQGGYEVEGFSTLSCILGPDGKPVWNHPQPVCTAPCGGQYVGSDGVVLSPNYPQNYT
SGQICLYFVTVPKDYVVFGQFAFFYTALNDVVEVHDGHNPHSQLLGSLSGSHTGESLPLA
TSNQVLIKFSAKGQVPARGFHFVYQAVPRTSATQCSSVPEPRYGRRLGSDFSVGATVRFE
CNSGYALQGSPEIECLPVPGALAQWNVSAPTCVVPCGGNLTERRGTILSPGFPEPYLNSL
NCVWKIMVPEGAGIQIQVVSFVTEQNWDSLEVFDGADNTVTMLGSFSGTTVPALLNSTSN
QLYLHFYSDISVSAAGFHLEYKTVGLSSCPEPAVPSNGVKTGERYLVNDVVSFQCEPGYA
LQGHAHISCMPGTVRRWNYPPPLCIAQCGGAVKDMDGVILSPGFPGSYPSNTDCSWQIAL
PVGFGAHIQFLNFSTEPNHDFIEIRNGPYETSRMMGRFSGSELPGALLSTSHETTVYFHS
DHSQNRPGFKLEYQAYELQECPDPEPFANGIVRGAGYNVGQSVTFECLPGYQLMGHPVLT
CQHGTNRNWDHPLPRCEVPCGGNVTSFNGTVYSPGFPSPYSSSQDCVWLITVPIGHGIRL
NISLLQTEPSGDFITVWDGPQQTAPQLGTFSHSLAKKTIHSSSNQVLLKFHRDAAAGGIF
AIAFSAYPLTKCPPPTILPNAEVVTENEEFNIGDIVRYRCLPGFTLVGNEILTCKLGTYL
QFEGPPPICEVHCPTNELLTDSTGVILSQSYPGSYPQFQTCSWLVRVEPEYNITLTVEYF
LSEKQYDEFEIFDGPSGQSPLLKALSGNYSAPLIVTSSSNSVYLRWSSDHAYNRKGFKIR
YAAPYCSLPRAPLHGFLLGQTTTQPGGSIHFGCNTGYRLVGHSMAICTRHPQGYHLWSEA
IPLCQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXLGNSMPTCQIISCGELPIPPNGHRIGTLSVYGATAIFSCNSGYTLVGSRVRECMANG
LWSGSEVRCLAPHLTKSHLIFYKLLFNLLSFPHPTKAGHCGTPEPIVNGQINGENYNYRG
SVVYQCNAGFRLIGMSVRICQQDHHWSGKTPFCVPITCGHPGNPMNGLTQGNQFNLNDVV
KFVCNPGYVAEGAARSQCLASGQWSDVLPTCRIINCTDPGHQENSVRQIHASGPHTFSYG
TTVSYQCNHGFYLLGTPVLSCQGDGTWDRPRPQCLLVSCGHPGSPPHSQMSGDNYTAGAV
VRYSCTSKRTLVGNATRMCGLDGHWTGSLPHCSGTSMGICGDPGIPAHGIRLGDSFAPGS
LMRFSCEAGHMLRGSSERTCQANGSWSGTQPECGVISCGNPGTPSNARVMFSDGLVFSSS
IVYECREGYYATGLLSRHCSVNGTWTGSDPECIVINCGDPGIPANGLRLGSDFRYNKTVT
YQCIPGYMMESHRVSVLSCTKDRTWNGTKPVCKAIMCKPPQLIPNGKVVGSDFMWGSSVT
YACLEGYQLSLPAVLTCEGNGSWTGELPQCFPVFCGDPGVPARGRREDRGFSYRSSVFFS
CQPPLVLVGSPRRFCQSDGTWSGTQPSCIDPTLTTCADPGVPQFGIQNNSQGYQVGSTVL
FRCQKGYLLQGSTTRTCLPNLTWSGTPPDCVXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRPSGRPINTAREPPLTQASVPGDVFAK
NSLWKGTYEYQGKKQPAMLRVTGFQVINSKVNATMIDHSGVELHLAGIYKKEDSHLLLQV
YQVTGPVEVFVNKFKGDHWALDGHVSPEFSGGTFIYQGAVKGQGFGQFGFQRLDLRLLES
DPESIGRHFASNSSSVAAAILVPFIALIIAGFVLYLYKHRRRPKVPFNGYAGHENTNVRA
TFENPMYDRNIQPTDIMATEAELTVSTVCTAV
Download sequence
Identical sequences ENSTTRP00000002120 ENSTTRP00000002120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]