SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002217 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002217
Domain Number 1 Region: 48-91
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000000604
Family EGF-type module 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002217   Gene: ENSTTRG00000002367   Transcript: ENSTTRT00000002367
Sequence length 133
Comment pep:known_by_projection scaffold:turTru1:scaffold_113996:169618:174378:1 gene:ENSTTRG00000002367 transcript:ENSTTRT00000002367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFGVSISVYILFNAVTALTEEAARTVTPPITTQQTGYTEGPIALRVSHPCLEDHHSYCI
NGVCAFHDELEKAICRCFAGYTGERCEHLTLTSYAVDPYEKYIAIGIGVGLLLSGFLVIF
YCYIKKRYEKNKL
Download sequence
Identical sequences ENSTTRP00000002217 ENSTTRP00000002217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]