SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002255 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002255
Domain Number 1 Region: 5-163
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.12e-22
Family Clostridium neurotoxins, the second last domain 0.029
Further Details:      
 
Domain Number 2 Region: 256-375,439-512
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.2e-16
Family Reprolysin-like 0.067
Further Details:      
 
Domain Number 3 Region: 385-548
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000000000415
Family Reprolysin-like 0.076
Further Details:      
 
Domain Number 4 Region: 1305-1372
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000128
Family Complement control module/SCR domain 0.0058
Further Details:      
 
Domain Number 5 Region: 1236-1308
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000417
Family Complement control module/SCR domain 0.003
Further Details:      
 
Domain Number 6 Region: 1175-1240
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000111
Family Complement control module/SCR domain 0.0046
Further Details:      
 
Domain Number 7 Region: 1104-1178
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000139
Family Complement control module/SCR domain 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000002255
Domain Number - Region: 571-590,771-830
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00215
Family Fibronectin type III 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002255   Gene: ENSTTRG00000002405   Transcript: ENSTTRT00000002406
Sequence length 1517
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3035:137543:388296:1 gene:ENSTTRG00000002405 transcript:ENSTTRT00000002406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLELPRDAFTLQVWLRAEGGQSSPAVITGLYDKCSYASRDRGWVVGIHTVSDQGNRDPRY
FFSLKTDRARQVTTINAHRSYLPGQWVHLAATYDGRLMKLYVNGAQVATSGEQVGGIFSP
LTQKCKVLMLGGSALNHNYRGYVERFSLWKAARTQREVLLDMETRGLHAPLPQLLLQENW
DNVKRAWSPMKDGSSPRVEASGARGFLLDTSLEPPLCGQTLCDNPKVISSYNQLPRFRRP
KAVRYRVVNLHDDGRENPTVSRQQIDFQHRQLAEAFKHYNISWELEVLEVSNSSLRRRLI
LANCDISKIGDENCDPECNHTLTGHDGGDCRHLRHPAFTKKQQNGVCDMDCNYERFNFDG
GECCDPEITDVTKTCFDPDSPHRAYLDVNELKNILRLDGSTHLNIFFANSSEEELAGVAT
WPWDKEALMHLGGIVLNPSFYGIPGHTHTMIHEIGHSLGLYHIFRGISEIQSCSDPCMET
EPSFETGDLCSDTNPAPKHKFCGDPGPGNDTCGFNSFFNTLYSNFMSYADDDCTDSFTPN
QVARMHCYLDLVYQSWQPSRKPAPVALAPQIVGHTTDSVMLEWFPPIDGHFFEXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHPDVEQPCKSSVRTWSPNSAVNPHT
VPPACPEPQGCYLELEFHYPLVPESLTIWVTFVSTDWDSSGAVNDIKLLTVSGKNISLGP
QNVFCDVPLTIKLRDVSEKVFGIQIYTLDEHLEIDAAMLTSVADTPLCLECKPLQYKVVR
DPPLQVDVASTLHFNRRFTDMDLHLGSVYQYWVITISGNEESEPSPAATYIHGSGYCGDG
IIQKSQGEECDDMNKINGDGCSLFCRQEVSFNCIDEPSRCYFHDGDGVCEEFEQKTSIKD
CGVYTPQGFLDQWASNASVSHQDQQCPGWVIIGQPAASQVCRTKVIDLSEGISQHAWYPC
TISYPYSQLAQTTFWLRAYFSQPMVAAAVIVHLVTDGTYYGDQKQETISVQLLDTKDQSH
DLGLHVLSCRNNPLIIPVVHDLSQPFYHSQAVRVSFSSPLVAISGVALRSFDNFDPVTLS
SCQRGETYSSAEQSCVHFACEAADCPKLAVENASLNCSSSDRYHGAQCTVSCRTGYVLQI
QRDDELIKSQTGPSVTVTCTEGKWNKQVVCEPVDCGVPDQHHVYAASFSCLKGTTFGSTC
SFQCRHPAQLKGNNSLLTCMEDGLWSFPEALCELLCLAPPPVPNADLQTARCRENKHKVG
SFCKYKCRPGYHVPGSSRKSKKRAFKTQCTQDGSWQEGACVPVTCDPPPPKFHGLYQCTN
GFQFNSECRVKCEDSDATQGHGSNVIHCRKDGTWSGSFHVCQEMQGQCSAPDQLNSNLKL
QCPAGYAIGSECATSCLDHNSESIILPVNVTVRDIPHWLNPTRVEXXXXXXXXXXXXXXX
XXXXXXXXXPFMGDNYCDAINNRAFCNYDGGDCCASTVKTKKVTPFPMSCDLQGDCACRD
PQAQEHSRKDLRGYSHG
Download sequence
Identical sequences ENSTTRP00000002255 ENSTTRP00000002255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]