SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002342 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002342
Domain Number 1 Region: 95-220
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000256
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002342   Gene: ENSTTRG00000002499   Transcript: ENSTTRT00000002499
Sequence length 683
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1649:85944:105274:1 gene:ENSTTRG00000002499 transcript:ENSTTRT00000002499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AERKQVPLSGWGAVGRRGRGAGHSSRMGGRPSSPLDKRQQQHLRGQVDTLLRNFLPCYRG
QLAASVLWQISRELGPQEPAGCQLLHSKKLPRVREHRGPLTQLQGHPPQWQPIFCVLRGD
GRLEWFRHREEYENGDRPLGSVVLTGYTVLTSQSEYLHLLDTLCPEPSGHHAQEEPDPLL
EMPVSFPLFLQHPFRRHLCFSAATAEVQRAWRLALQGGIRLRGTVLQRSQAPAARAFLDA
IRLYRQQQGHFGDDDVTLGSDAEVLTAVLMRELLPALRAQTLPGLRGAGRARAWAWAKLL
DAVHAAVLAGASTGLRAFQPEKEELLAALEKTIRPDVDQMLKLRERVLGRLQANVQGPLE
SCLRRKVDAQLPRVTQTLLSTVEAELTAVQTLLTQGMDRLSRHLRGSPSSTRLRKEVYSF
GEMPWDPELMQTCYREAERSRGRLGQLAEPFGFFGTQSLVFGAQDLAQQLMADAVATFLQ
LADQCLTTALDCDQAAQQLEKVRGRVLKKFQSDSGSARRRFIHGWLLCIFLPFVLSQLEL
SCKAELPEFEGDVLAVGSPALTIEGIYEDVIRGVLLQRINRELKKALGASNMSCTLDGCS
ELPWDQGETAPNLTLVSSFPAESRAFTAFLCLPEKPSVHWSLAASHHKTSSCFRSRFWEG
SPVFFSVQLSEGGNAHSMVSPRE
Download sequence
Identical sequences ENSTTRP00000002342 ENSTTRP00000002342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]